Loading...
Statistics
Advertisement

LIGHTS OF MADNESS by Preston Russell
www.prestonrussell.com/

Prestonrussell.com

Advertisement
Conversion Technology Metas Server
Prestonrussell.com is hosted in United States / Provo . Prestonrussell.com uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Google Font API, Html, Number of used javascripts: 13. First javascripts: Jquery.js, Jquery-migrate.min.js, Preloader.js, Number of used analytics tools: 0. Number of used plugins, modules: 1. Its server type is: Apache/2.2.25 (Unix) mod_ssl/2.2.25 OpenSSL/1.0.0-fips DAV/2 mod_bwlimited/1.4. Its CMS is: Wordpress.

Technologies in use by Prestonrussell.com

Technology

Number of occurences: 8
  • CSS
  • Google Font API
  • Html
  • Javascript
  • jQuery
  • Php
  • Pingback
  • SuperFish

Advertisement

Javascripts

Number of occurences: 13
  • jquery.js
  • jquery-migrate.min.js
  • preloader.js
  • respond.js
  • hoverIntent.js
  • superfish.js
  • jquery.prettyphoto.js
  • cntctfrm.js
  • jquery.tipsy.js
  • jquery.fitvids.js
  • natural_custom.js
  • comment-reply.min.js
  • wp-embed.min.js

Content Management System

Number of occurences: 1
  • Wordpress

Server Type

  • Apache/2.2.25 (Unix) mod_ssl/2.2.25 OpenSSL/1.0.0-fips DAV/2 mod_bwlimited/1.4

Powered by

  • PHP/5.3.26

Used plugins, modules

Number of plugins and modules: 1
  • contact form plugin

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Prestonrussell.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=EssentialSSL Wildcard/CN=*.mobileadder.com
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: EssentialSSL Wildcard
      • CN: *.mobileadder.com
    • hash: a9cb22ef
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: EssentialSSL CA
    • version: 2
    • serialNumber: 249501210071332670019151285732123522282
    • validFrom: 131216000000Z
    • validTo: 141216235959Z
    • validFrom_time_t: 1387152000
    • validTo_time_t: 1418774399
    • extensions:
      • authorityKeyIdentifier: keyid:DA:CB:EA:AD:5B:08:5D:CC:FF:FC:26:54:CE:49:E5:55:C6:38:F4:F8
      • subjectKeyIdentifier: D4:B3:0B:F3:82:2A:2A:EA:46:37:FE:3A:10:CD:3B:E2:0A:B9:F0:C8
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication, Microsoft Server Gated Crypto, Netscape Server Gated Crypto
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/EssentialSSLCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/EssentialSSLCA_2.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.mobileadder.com, DNS:mobileadder.com

Meta - Prestonrussell.com

Number of occurences: 3
  • Name:
    Content: text/html; charset=UTF-8
  • Name: viewport
    Content: width=device-width
  • Name: generator
    Content: WordPress 4.4.2

Server / Hosting

  • IP: 162.144.65.121
  • Latitude: 40.22
  • Longitude: -111.61
  • Country: United States
  • City: Provo

Rname

  • ns9.victoryehosting.com
  • ns8.victoryehosting.com
  • prestonrussell.com

Target

  • support.victoryehosting.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Date: Sun, 10 Apr 2016 19:49:57 GMT Server: Apache/2.2.25 (Unix) mod_ssl/2.2.25 OpenSSL/1.0.0-fips DAV/2 mod_bwlimited/1.4 X-Powered-By: PHP/5.3.26 Vary: Cookie Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Set-Cookie: bb2_screener_=1460317797+176.9.124.8; path=/ Set-Cookie: PHPSESSID=f17c528fc539a5b53861347a2adbeae3; path=/ Location: http://www.prestonrussell.com/ Content-Type: text/html; charset=UTF-8 HTTP/1.1 200 OK Date: Sun, 10 Apr 2016 19:49:57 GMT Server: Apache/2.2.25 (Unix) mod_ssl/2.2.25 OpenSSL/1.0.0-fips DAV/2 mod_bwlimited/1.4 Last-Modified: Sun, 10 Apr 2016 19:49:53 GMT ETag: "1ae904e-51df-53026bb5cdf74" Accept-Ranges: bytes Content-Length: 20959 Cache-Control: max-age=3, must-revalidate Expires: Sun, 10 Apr 2016 19:50:00 GMT Vary: Accept-Encoding,Cookie Content-Type: text/html; charset=UTF-8

DNS

host: prestonrussell.com
  1. class: IN
  2. ttl: 14398
  3. type: A
  4. ip: 162.144.65.121
host: prestonrussell.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns9.victoryehosting.com
host: prestonrussell.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns8.victoryehosting.com
host: prestonrussell.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns8.victoryehosting.com
  5. rname: support.victoryehosting.com
  6. serial: 2014082703
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: prestonrussell.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: prestonrussell.com
host: prestonrussell.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 +a +mx +ip4:162.144.65.121 ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.restonrussell.com, www.pirestonrussell.com, www.irestonrussell.com, www.pkrestonrussell.com, www.krestonrussell.com, www.purestonrussell.com, www.urestonrussell.com, www.pjrestonrussell.com, www.jrestonrussell.com, www.plrestonrussell.com, www.lrestonrussell.com, www.pestonrussell.com, www.priestonrussell.com, www.piestonrussell.com, www.proestonrussell.com, www.poestonrussell.com, www.prlestonrussell.com, www.plestonrussell.com, www.prlestonrussell.com, www.plestonrussell.com, www.pr.estonrussell.com, www.p.estonrussell.com, www.prstonrussell.com, www.prexstonrussell.com, www.prxstonrussell.com, www.presstonrussell.com, www.prsstonrussell.com, www.prewstonrussell.com, www.prwstonrussell.com, www.prerstonrussell.com, www.prrstonrussell.com, www.prefstonrussell.com, www.prfstonrussell.com, www.prevstonrussell.com, www.prvstonrussell.com, www.precstonrussell.com, www.prcstonrussell.com, www.preqstonrussell.com, www.prqstonrussell.com, www.preastonrussell.com, www.prastonrussell.com, www.preystonrussell.com, www.prystonrussell.com, www.pretonrussell.com, www.presetonrussell.com, www.preetonrussell.com, www.preswtonrussell.com, www.prewtonrussell.com, www.presdtonrussell.com, www.predtonrussell.com, www.presxtonrussell.com, www.prextonrussell.com, www.presftonrussell.com, www.preftonrussell.com, www.presgtonrussell.com, www.pregtonrussell.com, www.presttonrussell.com, www.prettonrussell.com, www.presonrussell.com, www.prestqonrussell.com, www.presqonrussell.com, www.prestaonrussell.com, www.presaonrussell.com, www.prest onrussell.com, www.pres onrussell.com, www.prestwonrussell.com, www.preswonrussell.com, www.presteonrussell.com, www.preseonrussell.com, www.prestzonrussell.com, www.preszonrussell.com, www.prestxonrussell.com, www.presxonrussell.com, www.prestconrussell.com, www.presconrussell.com, www.prestnrussell.com, www.prestobnrussell.com, www.prestbnrussell.com, www.prestohnrussell.com, www.presthnrussell.com, www.prestognrussell.com, www.prestgnrussell.com, www.prestojnrussell.com, www.prestjnrussell.com, www.prestomnrussell.com, www.prestmnrussell.com, www.presto nrussell.com, www.prest nrussell.com, www.prestovnrussell.com, www.prestvnrussell.com, www.prestorussell.com, www.prestonnrussell.com, www.prestonrussell.com, www.prestonhrussell.com, www.prestohrussell.com, www.prestonjrussell.com, www.prestojrussell.com, www.prestonkrussell.com, www.prestokrussell.com, www.prestonlrussell.com, www.prestolrussell.com, www.preston russell.com, www.presto russell.com, www.prestonussell.com, www.prestonriussell.com, www.prestoniussell.com, www.prestonroussell.com, www.prestonoussell.com, www.prestonrlussell.com, www.prestonlussell.com, www.prestonrlussell.com, www.prestonlussell.com, www.prestonr.ussell.com, www.preston.ussell.com, www.prestonrssell.com, www.prestonruwssell.com, www.prestonrwssell.com, www.prestonruessell.com, www.prestonressell.com, www.prestonrusssell.com, www.prestonrsssell.com, www.prestonruassell.com, www.prestonrassell.com, www.prestonrusell.com, www.prestonrusesell.com, www.prestonruesell.com, www.prestonruswsell.com, www.prestonruwsell.com, www.prestonrusdsell.com, www.prestonrudsell.com, www.prestonrusxsell.com, www.prestonruxsell.com, www.prestonrusfsell.com, www.prestonrufsell.com, www.prestonrusgsell.com, www.prestonrugsell.com, www.prestonrustsell.com, www.prestonrutsell.com, www.prestonrusell.com, www.prestonrusseell.com, www.prestonruseell.com, www.prestonrusswell.com, www.prestonruswell.com, www.prestonrussdell.com, www.prestonrusdell.com, www.prestonrussxell.com, www.prestonrusxell.com, www.prestonrussfell.com, www.prestonrusfell.com, www.prestonrussgell.com, www.prestonrusgell.com, www.prestonrusstell.com, www.prestonrustell.com, www.prestonrussll.com, www.prestonrussxll.com, www.prestonrussesll.com, www.prestonrusssll.com, www.prestonrussewll.com, www.prestonrusswll.com, www.prestonrusserll.com, www.prestonrussrll.com, www.prestonrussefll.com, www.prestonrussfll.com, www.prestonrussevll.com, www.prestonrussvll.com, www.prestonrussecll.com, www.prestonrusscll.com, www.prestonrusseqll.com, www.prestonrussqll.com, www.prestonrusseall.com, www.prestonrussall.com, www.prestonrusseyll.com, www.prestonrussyll.com,

Other websites we recently analyzed

  1. moneyinstruction.com
    Switzerland - 141.8.230.16
    Server software: nginx/1.9.9
    Technology: CloudFront, Google Adsense, CSS, Html, Javascript, Php
    Number of Javascript: 4
    Number of meta tags: 2
  2. lindseyhomes.biz
    Jacksonville (United States) - 206.188.193.174
    Server software: Apache
    Technology: CSS, Google Font API, Html, Javascript, jQuery
    Number of Javascript: 4
    Number of meta tags: 2
  3. schoenstejahreszeit.de
    Germany - 217.160.231.188
    Server software: Apache
    Technology: Html
    Number of meta tags: 3
  4. Serveur Minecraft 1.8 français - Minecraft-Addict.com
    Serveur minecraft 1.8 francophone le plus fun ! Tout minecraft en quelques clics! Maps survie/semi-RP/rpg , pvp/faction et creatif. Compétances RPG, sorts à collectionner, site web interactif, venez découvrir la communauté de notre serveur Minecraft 1.8 !
    France - 37.187.89.200
    Server software: Apache
    Technology: Google Adsense, CSS, Font Awesome, Html, Html5, Javascript, jQuery, jQuery UI, Php
    Number of Javascript: 5
    Number of meta tags: 4
  5. ULKUCU HACKTEAM
    Brea (United States) - 64.90.40.14
    Server software: Apache
    Technology: CSS, Google Font API, Html, Javascript, Php, SVG, Wordpress
    Number of Javascript: 1
    Number of meta tags: 4
  6. Service4Logistic
    Poland - 79.96.238.137
    Server software: IdeaWebServer/v0.80
    Technology: CSS, Html, Javascript, jQuery
    Number of Javascript: 2
    Number of meta tags: 4
  7. cnfocus
    Beijing (China) - 114.113.158.13
    Server software: Apache/2.2.8 (Win32) PHP/5.2.6
    Technology: CSS, Html, Php
    Number of Javascript: 2
    Number of meta tags: 2
  8. 拉索城堡官方网站
    拉索城堡-----世界因我而不同，官方客服电话：4006-120-289。1
    Central District (Hong Kong) - 121.127.234.105
    Server software: Microsoft-IIS/6.0
    Technology: CSS, Html, Javascript, jQuery
    Number of Javascript: 3
    Number of meta tags: 3
  9. iri.hs.kr
    Korea, Republic of - 211.210.30.141
    Server software:
    Technology: Javascript
  10. saltlakevalleycarpetcleaning.info
    Scottsdale (United States) - 184.168.221.42
    Server software:
    Technology: Html, Html5, Iframe

Check Other Websites